Shenzhen Haiwen Biotechnology Co., Ltd. is a Manufacture of Raw Steroids Powder , semi-finished oils,Finished Liquid , HGH , Peptides and LOCAL ANESTHETIC DRUGS in China .

Sales & Support
Request A Quote -
Select Language
Home
Products
About Us
Factory Tour
Quality Control
Contact Us
Request A Quote
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
HomeProducts

Hair Growth Powder

I have received my products , you packing is do discreet and perfect , it really amazed me .i will order more from you as soon as possible . Tks!

—— Robet--Australia

I have cooperated with you for many times , your product quality is so great , that is why i still buy the products from you . thank you

—— Richard---American

Hi mate, your best price and high purity product is so competitive in my country , this let me make much profit , my customers are really like it .tks

—— Johnson---Canada

I'm Online Chat Now

Hair Growth Powder

(115)
China 99.5% High Purity Minoxidil USP34 Hair Growth Powder Pharmaceutical CAS 38304-91-5 distributor

99.5% High Purity Minoxidil USP34 Hair Growth Powder Pharmaceutical CAS 38304-91-5

99.5% High Purity Minoxidil USP34 Hair Growth Powder Pharmaceutical CAS 38304-91-5 Quick Detail: Minoxidil or Minoxidil sulphate is a kind of Hypotensive , reducing blood press , External Promoting Hair ...    Read More
2019-03-13 17:06:34
China BPH Hair Growth Powder Avodart / Dutasteride 164656-23-9 Duagen distributor

BPH Hair Growth Powder Avodart / Dutasteride 164656-23-9 Duagen

BPH Hair Growth Powder Avodart / Dutasteride 164656-23-9 Duagen Dutasteride (Avodart) product Name:Dutasteride Molecular Weight:L28.5297 InChI:nChI=1/C27H30F6N2O2 /c1-24-11-9-17-15(4-8-21-25(17,2)12-10-22(36)35...    Read More
2019-03-13 17:06:29
China Lyophilized Inject 2mg/vial Hair Growth Steroid Sermorelin Polypeptide distributor

Lyophilized Inject 2mg/vial Hair Growth Steroid Sermorelin Polypeptide

Lyophilized Inject 2mg/vial Hair Growth Steroid Sermorelin Polypeptide Quick Detail: Product Name:Sermorelin Synonyms:SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR...    Read More
2019-03-13 17:06:33
China Oral Hongdenafil Hair Growth Powder White Crystalline CAS 98319-26-7 distributor

Oral Hongdenafil Hair Growth Powder White Crystalline CAS 98319-26-7

Oral Hongdenafil Hair Growth Powder White crystalline CAS 98319-26-7 Quick Detail: Product name Hongdenafil Other name Acetildenafil CAS register number 831217-01-7 Molecular formula C25H34N6O3 Molecular weight ...    Read More
2019-03-13 17:06:25
China Aphrodisiac Peptide White Hair Growth Steroid PT141 Acetate CAS 32780-32-8 distributor

Aphrodisiac Peptide White Hair Growth Steroid PT141 Acetate CAS 32780-32-8

Aphrodisiac Peptide White Hair Growth Steroid PT141 Acetate CAS 32780-32-8 Quick Detail: Bremelanotide; PT-141 CAS No.: 32780-32-8 MOQ: 20Vials Purity (HPLC): 98.0%min. Molecular Formula: C50H68N14O10 Molecular ...    Read More
2019-03-13 17:06:27
China Health 99% Hair Growth Powder Dutasteride Avodart Anti-estrogen Steroids distributor

Health 99% Hair Growth Powder Dutasteride Avodart Anti-estrogen Steroids

Health 99% Hair Growth Powder Dutasteride Avodart Anti-estrogen Steroids Quick Detail: Product name;Dutasteride Alias;Avodart CAS No.164656-23-9 Molecular formula;C27H30F6N2O2 Molecular weight;528.53 Appearance...    Read More
2019-03-13 17:06:20
China White Crystalline Solid Hair Growth Steroid Finasteride Proscar Anti-estrogen Steroids distributor

White Crystalline Solid Hair Growth Steroid Finasteride Proscar Anti-estrogen Steroids

White Crystalline Solid Hair Growth Steroid Finasteride Proscar Anti-estrogen Steroids Quick Detail: Product name: Finasteride Alias: Proscar CAS: 98319-26-7 MF: C23H36N2O2 MW: 372.55 Purity: 99.68% Appearance: ...    Read More
2019-03-13 17:06:20
China 98319-26-7 Hair Growth Powder Finasteride Propecia Treat Hair Loss distributor

98319-26-7 Hair Growth Powder Finasteride Propecia Treat Hair Loss

98319-26-7 Hair Growth Powder Finasteride Propecia Treat Hair Loss Quick Detail: Product Name Finasteride CAS Registry Number 98319-26-7 Molecular Formula C23H36N2O2 Molecular Weight 372.5441 InChI: InChI=1...    Read More
2019-03-13 17:06:02
China Potent Herbal Extract Hair Growth Steroid Minoxidil CAS 38304-91-5 distributor

Potent Herbal Extract Hair Growth Steroid Minoxidil CAS 38304-91-5

Potent Herbal Extract Hair Growth Steroid Minoxidil CAS 38304-91-5 Dear, SMQ have exported such products for 12 years, high quality with good price and quick response, welcome to contact ycsmq@yuanchengtech.com ...    Read More
2019-03-13 17:06:09
China Natural Hair Growth Powder 57-85-2 Testoviron Testosterone Propionate Powders distributor

Natural Hair Growth Powder 57-85-2 Testoviron Testosterone Propionate Powders

Natural Hair Growth Powder 57-85-2 Testoviron Testosterone Propionate Powders 1. Quick Detail: English name: Testosterone Propionate English Name: 17beta- (Propionyloxy) androst-4-en-3-one; 17beta-Hydroxy-4...    Read More
2019-03-13 17:06:15
Page 1 of 12 |< << 1  2  3  4  5  6  7  8  9  10  >> >|