Shenzhen Haiwen Biotechnology Co., Ltd. is a Manufacture of Raw Steroids Powder , semi-finished oils,Finished Liquid , HGH , Peptides and LOCAL ANESTHETIC DRUGS in China .

Sales & Support
Request A Quote -
Select Language
Home
Products
About Us
Factory Tour
Quality Control
Contact Us
Request A Quote
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
HomeProductsHair Growth Powder

Lyophilized Inject 2mg/vial Hair Growth Steroid Sermorelin Polypeptide

I have received my products , you packing is do discreet and perfect , it really amazed me .i will order more from you as soon as possible . Tks!

—— Robet--Australia

I have cooperated with you for many times , your product quality is so great , that is why i still buy the products from you . thank you

—— Richard---American

Hi mate, your best price and high purity product is so competitive in my country , this let me make much profit , my customers are really like it .tks

—— Johnson---Canada

I'm Online Chat Now

Lyophilized Inject 2mg/vial Hair Growth Steroid Sermorelin Polypeptide

Lyophilized Inject 2mg/vial Hair Growth Steroid Sermorelin Polypeptide supplier Lyophilized Inject 2mg/vial Hair Growth Steroid Sermorelin Polypeptide supplier

Large Image :  Lyophilized Inject 2mg/vial Hair Growth Steroid Sermorelin Polypeptide

Product Details:

Place of Origin:china
Brand Name:SMQ
Certification:USP,SGS
Model Number:86168-78-7

Payment & Shipping Terms:

Minimum Order Quantity:1kg
Price:USD 10g
Packaging Details:as you required
Delivery Time:1-3 day
Payment Terms:Western Union, MoneyGram, T/T
Supply Ability:1000kg/week
Detailed Product Description
Name: Sermorelin Formula: C149H246N44O42S
Application: Peptide Drum Appearance: Lyophilized Powder
Skype: Nicole0918 Email: 2355935183@ycphar.com

Lyophilized Inject 2mg/vial Hair Growth Steroid Sermorelin Polypeptide

 

 

Quick Detail:


Product Name:Sermorelin
Synonyms:SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
CAS:86168-78-7
MF:C149H246N44O42S
MW:3357.88
Product Categories:Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors
Usage:xanthine oxidase inhibitor

 
Packaging & Delivery Process:
 
1. Delivery : Parcels would be arranged within 12 hours upon receipt your payment .
2. Packing : Steroids powders would be packed discreetly enough to cross customs
3. worldwide safely . Packing like traditional chinese food , washing and bathing items and other equipments, etc...
4. Extra service : Photos of of package would be provided for you to tell apart the steroids .
5.Tracking number would be offered once it is released .
6.After-sale service: Any questions after you got the parcel, please contact us for the first time .Problems would be solved for you immediately.

 
Competitive Advantage:
 

  1. Rich experience in loading a great amount of containers in Chinese sea port;
  2. Fast shipment by well-reputed shipping line;
  3. Packaging with pallets according to buyers’ special request;
  4. Providing best service after shipment by e-mail;
  5. Cargoes together with container sales service available;
  6. Providing photos of cargoes before and after loading into container;
  7. Raw materials from Chinese origin;

 

Related  products:

 

Polypeptide Series

 Product Name

Specification

MGF

2mg/vial

PEG MGF

2mg/vial

CJC-1295 with DAC

2mg/vial

CJC-1295 without DAC

2mg/vial

PT-141

10mg/vial

MT-1

10mg/vial

MT-2

10mg/vial

GHRP-2

10mg/vial

GHRP-2

5mg/vial

GHRP-6

10mg/vial

GHRP-6

5mg/vial

Ipamorelin

2mg/vial

Hexarelin

2mg/vial

Sermorelin

2mg/vial

Oxytocin

2mg/vial

 TB500

2mg/vial

pentadecapeptide BPC 157

2mg/vial

HGH 176-191

2mg/vial

Triptorelin2mg/vial
Tesamorelin2mg/vial
Gonadorelin2mg/vial
Gonadorelin10mg/vial
DSIP2mg/vial
Selank5mg/vial

 

 

 
 
Lyophilized Inject 2mg/vial Hair Growth Steroid Sermorelin Polypeptide

Contact Details
Shenzhen Haiwen Biotechnology Co.,Ltd

Contact Person: Mrs. Lisa

Send your inquiry directly to us (0 / 3000)

Other Products

99.5% High Purity Minoxidil USP34 Hair Growth Powder Pharmaceutical CAS 38304-91-5

BPH Hair Growth Powder Avodart / Dutasteride 164656-23-9 Duagen

Lyophilized Inject 2mg/vial Hair Growth Steroid Sermorelin Polypeptide

Oral Hongdenafil Hair Growth Powder White Crystalline CAS 98319-26-7

Aphrodisiac Peptide White Hair Growth Steroid PT141 Acetate CAS 32780-32-8

Health 99% Hair Growth Powder Dutasteride Avodart Anti-estrogen Steroids

White Crystalline Solid Hair Growth Steroid Finasteride Proscar Anti-estrogen Steroids