Shenzhen Haiwen Biotechnology Co., Ltd. is a Manufacture of Raw Steroids Powder , semi-finished oils,Finished Liquid , HGH , Peptides and LOCAL ANESTHETIC DRUGS in China .

Sales & Support
Request A Quote -
Select Language
Home
Products
About Us
Factory Tour
Quality Control
Contact Us
Request A Quote
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
HomeProducts

steroids for hair growth

I have received my products , you packing is do discreet and perfect , it really amazed me .i will order more from you as soon as possible . Tks!

—— Robet--Australia

I have cooperated with you for many times , your product quality is so great , that is why i still buy the products from you . thank you

—— Richard---American

Hi mate, your best price and high purity product is so competitive in my country , this let me make much profit , my customers are really like it .tks

—— Johnson---Canada

I'm Online Chat Now

steroids for hair growth

(228)

Hair Loss Treatment Drug Minoxidil 99% Min Hair Growth Powder 38304-91-5

Hair Loss Treatment Drug Minoxidil 99% Min Hair Growth Powder 38304-91-5 1. Basic Description: Minoxidil is an antihypertensive vasodilator medication. It also slows or stops hair loss and promotes hair ...Read More
2019-03-13 17:06:04

White Crystalline Solid Hair Growth Steroid Finasteride Proscar Anti-estrogen Steroids

White Crystalline Solid Hair Growth Steroid Finasteride Proscar Anti-estrogen Steroids Quick Detail: Product name: Finasteride Alias: Proscar CAS: 98319-26-7 MF: C23H36N2O2 MW: 372.55 Purity: 99.68% Appearance: ...Read More
2019-03-13 17:06:20

Testosterone Enanthate Hair Growth Powder Hormone BodyBuilding 315-37-7

Testosterone Enanthate Hair Growth Powder Hormone BodyBuilding 315-37-7 1. Quick Detail: Product name Testosterone Enanthate Factory Supplying Other name Testosterone enantate; testosterone enthanoate; ...Read More
2019-03-13 17:06:15

Hair Loss Treatment Drug Minoxidil Purity 99% Min Hair Growth Powder CAS 38304-91-5

Hair Loss Treatment Drug Minoxidil 99% Min Hair Growth Powder 38304-91-5 1. Basic Description: Minoxidil is an antihypertensive vasodilator medication. It also slows or stops hair loss and promotes hair ...Read More
2019-03-13 17:06:13

Anesthetic Hair Growth Powder Proscar Anodyne 98319-26-7 Finasteride , Prostide

Hair Growth Powder Safe Proscar local Anesthetic Drugs Anodyne CAS 98319-26-7 Finasteride,Prostide 1. Quick Detail: Product name Formestane Factory Supplying Other name Lentaron; 4-hydroxy-androst-4-ene-17...Read More
2019-03-13 17:06:14

Dutasteride Hair Growth Steroid Hormone Powder Avodart for Hair Loss Treatment

Self Introduction: Our company have been doing this line for more than 10 years, we are experienced with the special product, safe shipping and high success for customs passing, welcome here for consult: Email...Read More
2019-03-13 17:06:06

Dutasteride Avodart​ Hair Growth Steroid 99% Pharma Grade 164656-23-9

Dutasteride Avodart Hair Growth Steroid 99% Pharma Grade 164656-23-9 Basic Description: Dutasteride (Avodart), manufactured by GlaxoSmithKline, is a dual 5- reductase inhibitor that inhibits conversion of ...Read More
2019-03-13 17:06:13

Enlarged Prostate Treatment Hair Growth Steroid 164656-23-9 Duagen

Enlarged Prostate Treatment Hair Growth Steroid 164656-23-9 Duagen 1. Quick Detail: Dutasteride Alias: Avodart ; Duagen CAS NO: 164656-23-9 MF: C27H30F6N2O2 MW: 528.53 Purity: 99% Appearance:white powder. Used ...Read More
2019-03-13 17:06:15

Finasteride Hair Growth Steroid Hormone Powder Proscar / Propecia

Self Introduction: Our company have been doing this line for more than 10 years, we are experienced with the special product, safe shipping and high success for customs passing, welcome here for consult: Email...Read More
2019-03-13 17:06:06

Lyophilized Inject 2mg/vial Hair Growth Steroid Sermorelin Polypeptide

Lyophilized Inject 2mg/vial Hair Growth Steroid Sermorelin Polypeptide Quick Detail: Product Name:Sermorelin Synonyms:SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR...Read More
2019-03-13 17:06:33
Page 1 of 10 |< << 1  2  3  4  5  6  7  8  9  10  >> >|